PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG034664t1
Common NameTCM_034664
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 142aa    MW: 16740.7 Da    PI: 6.1305
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG034664t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.41.5e-1355107456
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                        +++rr+++NRe+ArrsR RKk  +e+ +e+v  L  eN++Lk++l+   +++
  Thecc1EG034664t1  55 ERKQRRMISNRESARRSRWRKKRHLENVTEEVNRLNRENQQLKNRLSLVINHC 107
                       589*****************************************999887777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.3E-1352123IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.6E-1153104No hitNo description
PROSITE profilePS5021710.93254101IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.94E-1156109No hitNo description
PfamPF001706.9E-1156107IPR004827Basic-leucine zipper domain
CDDcd147026.54E-1557108No hitNo description
PROSITE patternPS0003605974IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MFVTEEAVQF QLPVHETVFT PEEVEELLSY LETDEPISPN SGSEGSSRAI YSADERKQRR  60
MISNRESARR SRWRKKRHLE NVTEEVNRLN RENQQLKNRL SLVINHCHVV WRENEQLRSE  120
SEALWAKLLD LYWTLAAMQS Q*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007018448.12e-99Basic leucine-zipper 4, putative
TrEMBLA0A061FFM72e-99A0A061FFM7_THECC; Basic leucine-zipper 4, putative
STRINGPOPTR_0014s01390.11e-50(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122322432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59530.14e-27basic leucine-zipper 4
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]